PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G065500.1.p
Common NameLOC101760048, SETIT_013948mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 372aa    MW: 39186.4 Da    PI: 9.39
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G065500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-1295139347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+++++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  Seita.6G065500.1.p  95 AWTEEEHKKFLLGLNKLGKGDWRGISRNYVISRTPTQVASHAQKY 139
                         7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6972338IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.103.3E-42341IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.29787144IPR017930Myb domain
SuperFamilySSF466895.91E-1689145IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1791143IPR006447Myb domain, plants
SMARTSM007171.6E-1092142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-1094141IPR009057Homeodomain-like
CDDcd001678.28E-995140No hitNo description
PfamPF002494.2E-1195139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MMRDGAPPAA PAAGVGGGGD GPRRCSQCGH HGHNARTCTA RPVKLFGVRI GDKPMRKSAS  60
MGNLAQLAAE GSGGGGREEG YGSDGERPHK KRGEAWTEEE HKKFLLGLNK LGKGDWRGIS  120
RNYVISRTPT QVASHAQKYF NRQTNVHRRK RRSSLFDMVI DDSSDQLPLS RSSSQEVEQH  180
LDDPQPVGAV PAPVVSPAAV APPPVSVEAP ASLPPPVQVP IPVTAPVVTP QLMEQDSVPS  240
SSSAGETGVV MPEAMPPYLY PMMIPPPYYH PAFVPVPCYG YVPFYYGPPG AAQAPHQVVK  300
PVAVHSTPPL NVKDLYNMSE LSLKGDDSNA NSGVPASPLP PKPIGRPERQ SAFHGKGPSG  360
GSSGGLIPAV K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972870.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLK3YI790.0K3YI79_SETIT; Uncharacterized protein
STRINGSi013948m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129002629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-41MYB_related family protein